Skip to product information
1 of 7

VEGF-165 Recombinant Protein

VEGF-165 Recombinant Protein

Regular price $115.00
Regular price Sale price $115.00
Sale Sold out
Shipping calculated at checkout.
Size

Product Description

VEGF-165, or vascular endothelial growth factor 165, is a protein that plays a crucial role in angiogenesis, which is the formation of new blood vessels. It's a member of the PDGF (Platelet-Derived Growth Factors) family that is characterized by the presence of eight conserved cysteine residues and a cystine knot structure.

In simpler terms, it's like a molecular architect that signals the body to build new blood vessels, particularly important in processes like wound healing and the development of collateral blood vessels to improve blood flow in ischemic tissues. This specific isoform, VEGF-165, is one of several VEGF isoforms, each with slightly different properties and functions.

Our products are produced using a proprietary plant based expressed system.

  • Animal Component Free (ACF). No endotoxins, prions or virons to risk microbial contamination.
  • Highly flexible platform used to produce multiple proteins with minimal changes to method.
  • Because of the plant based source, our proteins generally have been found to have a 10% to 20% higher activity compared to e.coli.

Purchase Through Fisher Scientific (No Discount)

Price Match Guarantee

If you find a lower price of VEGF-165 recombinant protein, send us a copy of the estimate or a link to the online listing and we'll match the price for quantity. It's that EASY! Send to orders@mnpharm.com.

Current Lead Time

1-2 Working Days 

Product Specifications

Species
Human*
Expression System Nicotiana Benthamiana
Purity >95% by SDS-PAGE
Activity
0.3-3.75 ng/mL EC50
Activity Assay Induced HUVEC proliferation assay data
Cell proliferation is measured by Rezasurin
rhVEGF165 MNPHARM, ED50 = 4.557 ng/mL
Using 2 mg/mL concentration measurement
Animal Component Free (ACF) Yes
Molecular Weight
38.2 kDa
Structure Disulfide-linked homodimer
Endotoxin Concentration
<1 EU/µg
Purification Sequential Chromatography
Form
Frozen
Formulation Supplied as a 0.22 µm filtered solution, 25 mM HEPES, 150 mM NaCl, 10% glycerol, pH 7.0

*For Research Use Only

Sequence

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

MNPharm Guarantee

If your product VEGF-165 is within its expiration period, and has not performed according to expectations, fill out the sample return form. Return the unused sample frozen, with the auto generated packing slip to the address on the instructions. You will receive a full refund along with a replacement of the unused portion (inclusive of the failed test). Damages do not cover any additional costs incurred for failed experimentation. 

Storage Instructions

Store in aliquots at -20°C or -80°C.
We recommend that single use aliquots are prepared to avoid freeze-thaw cycles.

Sample Prep Instructions 

  1. Thaw the vial on ice, spin briefly
  2. Prepare single-use or stock aliquots. This stage will depend on your final application so please adapt as appropriate. All our proteins are supplied carrier protein-free. If compatible with your work and you are storing at lower concentrations (<50 ug/ml) adding carrier protein is highly advised (usually 1% w/v high purity BSA or equivalent – ensure all buffers are sterile-filtered).
  3. Prepare single-use aliquots whenever possible to avoid freeze-thaw cycles which can damage the proteins and reduce bioactivity. Store aliquots at -70 °C (or -20 °C)
  4. We recommend sterile filtering after dilution in media or the final working solution

Bioinformatics

Alternative Names: MVCD1; MVCD-1; VAS; vascular endothelial growth factor A; Vascular endothelial growth factor 2; Vascular permeability factor; Vasculotropin; VEGF; VEGFA; VEGF-A; VEGFMGC70609; VPF; VPF vascular endothelial growth factor; MGC70609

UniProt ID: (Human) P15692

Entrez Gene ID: (Human) 7422

 

Documents & Downloads

      

COA is included in the shipment


References

  1. Leung, D.W. et al. (1989) Science 246:1306.
  2. Keck, P.J. et al. (1989) Science 246:1309.
  3. Byrne, A.M. et al. (2005) J. Cell. Mol. Med. 9:777.
  4. Robinson, C.J. and S.E. Stringer (2001) J. Cell. Sci. 114:853.
  5. Pan, Q. et al. (2007) J. Biol. Chem. 282:24049.
  6. Weis, S.M. and D.A. Cheresh (2005) Nature 437:497.
  7. Thurston, G. (2002) J. Anat. 200:575.
  8. Carvalho, J.F. et al. (2007) J. Clin. Immunol. 27:246.
  9. Angelo, L.S. and R. Kurzrock (2007) Clin. Cancer Res. 13:2825.
  10. Apte, R.S. et al. (2019) Cell 176(6):1248.
  11. Sangro, B. et al. (2021) Nature 18:525-543.
  12. Hu, K. & Olsen, B.R. (2016) Bone 91:30-38.
  13. Zhou, Y. et al. (2022) Cancers 14:2266.
  14. Li, Y. et al. (2018) Cell Stem Cell 23(2):181-192.
  15. Musah, S. et al. (2018) Nat. Protoc. 13(7):1662-1685.
  16. Meseguer-Ripolles, J. et al. (2021) STAR Protoc. 2(2):100502.
  17. Hutchings, G. et al. (2020) Int. J. Mol. Sci. 21(11):3790.
  18. Zhang, W. et al. (2014) Euro Cell and Mater. 27:1-12.
View full details