Human Recombinant VEGF-165 Protein

Order and SAVE up to 70% 

MNPHARM has partnered with Fisher Scientific and Government Scientific Source to help distribute our products. Order your proteins from MNPHARM through either the Fisher Scientific or Government Scientific Source links provided and SAVE up to 70% over other suppliers.

Click the Fisher Scientific logo below to place your order. 

  • Pricing:
  • 10ug = $93.93
  • 50ug = $295.43
  • 500ug = $744.25
  • 1,000ug = $1,381.25

Approved Government Scientific Source customers, click the logo below.

 

 

Human Recombinant VEGF-165 Protein:

Vascular endothelial growth factor (VEGF), originally known as vascular permeability factor (VPF), is a signal protein produced by cells that stimulates the formation of blood vessels. It is a member of the PDGF family that is characterized by the presence of eight conserved cysteine residues and a cysteine knot structure. It is part of the system that restores the oxygen supply to tissues when blood circulation is inadequate such as in hypoxic conditions.

For Research Use Only – Our products are produced using a proprietary plant based expressed system.

  • DESCRIPTION = Recombinant human VEGF-165 produced in plants contains 165 amino acids and has a predicted molecular mass of 19.2 kDa. The predicted mass of the dimer is 38.4 kDa. As a result of glycosylation, the recombinant protein migrates with an apparent molecular mass of 26.28 kDa in SDS-PAGE.
  • SOURCE = Nicotiana Benthamiana Plant
  • AA Sequence = APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPGPHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
  • ACF = Animal Component Free. Low endotoxins, prions or virons to risk microbial contamination.
  • PURITY = > Purity 95%, as determined by SDS-Page
  • BIOACTIVITY = VEGF was measured as ED50=2.3ng/ml
  • FORMULATION = VEGF-165 delivered soluble/frozen carrier-free. Does not contain BSA.
  • STABILITY = Recombinant Proteins are stable for up to 6 months from date of receipt at -20C, one year at -80C
  • STORAGE = Until use, Human VEGF-165 should be stored at 4C between 2-7 days and for future use below -18C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

Additional Information:

  • Expression of desired protein takes 7 days. Only 12 days for the entire process for quick delivery.
  • Highly flexible platform used to produce multiple proteins with minimal changes to method.
  • Our proteins generally have 10% to 20% higher activity.
  • Our fusion tech is highly-engineered and tested to be hyper-thermal stable and protease-resistant.

Our proteins are shipped overnight and arrive frozen – (Store at -80C)
Contact us for bulk or custom order options at orders@MNPHARM.com

Order Information:

MNPHARM SBC works in partnership with Fisher Scientific for distribution.

  • Pricing:
  • 10ug = $93.93
  • 50ug = $295.43
  • 500ug = $744.25
  • 1,000ug = $1,381.25

Click the Fisher Scientific logo below to order. 

 

 

 

 

 

 

 

Approved Government Scientific Source customers, click the logo below.

 

 

 

TERMS AND CONDITIONS:

The following limitation applies to MNPHARMS’ warranty and liability for damages: All products are warranted to meet MNPHARMS’ published specifications when used under normal laboratory conditions.

MNPHARM DOES NOT MAKE ANY OTHER WARRANTY OR REPRESENTATION WHATSOEVER, WHETHER EXPRESS OR IMPLIED, WITH RESPECT TO ITS PRODUCTS.

MNPHARM is working towards becoming a cGMP (Current Good Manufacturing Practices) compliant manufacturer and expects to complete this process in early 2021. Until the completion of our efforts to become cGMP compliant, our products are available FOR RESEARCH USE ONLY.